Serum Amyloid P, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 0.25mg
Host Human
ArtNr PR50116
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 96% by SDS-PAGE
Presentation
Liquid in .01M Tris Buffer pH 8.0, .015M NaCl, .01M EDTA
Sequence
MNKPLLWISVLTSLLEAFAHTDLSGKVFVFPRESV TDHVNLITPLEKPLQNFTLCFRAYS DLSRAYSLF SYNTQGRDNELLVYKERVGEYSLYIGRHKVTSKVI EKFPAPVHICVSWESS SGIAEFWINGTPLVKKGL RQGYFVEAQPKIVLGQEQDSYGGKFDRSQSFVGEI GDLYMWD SVLPPENILSAYQGTPLPANILDWQAL NYEIRGYVIIKPLVWV
Storage
-60C or below
Associated Disease
Cardiac
Entrez Gene
325
Omim
104770
Swiss Prot
P02743
Unigene
Hs.507080
Molecular Weight
25 kDa
Amount: 0.25mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close