Retinol-Binding Protein (RBP), Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 1mg
Host Human
ArtNr PR80011
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophilized
Sequence
MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIAN LLKPDKEIVQDGDHMIIRTLSTFRN YIMDFQVGK EFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEG RGWTQWIEGDELHLEM RVEGVVCKQVFKKVQ
Storage
-60C or below
Associated Disease
Diabetes
Entrez Gene
5947, 5948, 5950
Omim
180260, 180280, 180250
Swiss Prot
P02753, P09455, P50120
Unigene
Hs.529571, Hs.655516, Hs.50223
Molecular Weight
17 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close