Thyroxine Binding Globulin, Human

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Human
Amount 1mg
Host Human
ArtNr PT62051
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Lyophlized
Sequence
MSPFLYLVLLVLGLHATIHCASPEGKVTACHSSQP NATLYKMSSINADFAFNLYRRFTVE TPDKNIFFS PVSISAALVMLSFGACCSTQTEIVETLGFNLTDTP MVEIQHGFQHLICSLN FPKKELELQIGNALFIGK HLKPLAKFLNDVKTLYETEVFSTDFSNISAAKQEI NSHVEMQ TKGKVVGLIQDLKPNTIMVLVNYIHFK AQWANPFDPSKTEDSSSFLIDKTTTVQVPMMHQ M EQYYHLVDMELNCTVLQMDYSKNALALFVLPKEGQ MESVEAAMSSKTLKKWNRLLQKGW VDLFVPKFSI SATYDLGATLLKMGIQHAYSENADFSGLTEDNGLK LSNAAHKAVLHIGEK GTEAAAVPEVELSDQPENT FLHPIIQIDRSFMLLILERSTRSILFLGKVVNPTE
Storage
-60C or below
Associated Disease
Hormones
Entrez Gene
6906
Omim
314200
Swiss Prot
P05543
Unigene
Hs.76838
Molecular Weight
46 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close