Fibrinogen, Murine

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Mouse
Amount 1mg
Host Murine
ArtNr PF10511
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 80% by SDS-PAGE
Presentation
Liquid in 20 mM sodium citrate-HCl/ pH 7.4
(pH 7.2 + 0.2) containing 0.15 % Sodium Azide
Sequence
A Chain - MLSLRVTCLILSVASTVWTTDTEDK GEFLSEGGGVRGPRVVERHQSQCKDSDWPFCSDDD WNHKCPSGCRMKGLIDEANQDFTNRINKLKNSLF DFQRNNKDSNSLTRNIMEYLRGDFAN ANNFDNTY GQVSEDLRRRIEILRRKVIEKAQQIQALQSNVRAQ LIDMKRLEVDIDIKIRS CKGSCSRAVNREINLQD YEGHQKQLQQVIAKELLPTKDRQYLPALKMSPVPD LVPGSFKS QLQEAPPEWKALTEMRQMRMELERPG KDGGSRGDSPGDSRGDSRGDFATRGPGSKAENPT NPGPGGSGYWRPGNSGSGSDGNRNPGTTGSDGTGD WGTGSPRPGSDSGNFRPANPNWGVF SEFGDSSSP ATRKEYHTGKAVTSKGDKELLIGKEKVTSSGTSTT HRSCSKTITKTVTGPD GRREVVKEVITSDDGSDC GDATELDISHSFSGSLDELSERHPDLSGFFDNHFG LISPNFK EFGSKTHSDSDILTNIEDPSSHVPEFS SSSKTSTVKKQVTKTYKMADEAGSEAHREGETR N TKRGRARARPTRDCDDVLQTQTSGAQNGIFSIKPP GSSKVFSVYCDQETSLGGWLLIQQ RMDGSLNFNR TWQDYKRGFGSLNDKGEGEFWLGNDYLHLLTLRGS VLRVELEDWAGKEAY AEYHFRVGSEAEGYALQVS SYRGTAGDALVQGSVEEGTEYTSHSNMQFSTFDRD ADQWEE NCAEVYGGGWWYNSCQAANLNGIYYPGG TYDPRNNSPYEIENGVVWVPFRGADYSLRAVR MK IRPLVGQ B Chain - MRHLWLLLLLCVFSVQT QAADDDYDEPTDSLDARGHRPVDRRKEEPPSLRPA PPPISGGG YRARPAKATANQKKVERRPPDAGGCL HADTDMGVLCPTGCTLQQTLLNQERPIKSSIAEL NNNIQSVSDTSSVTFQYLTLLKDMWKKKQAQVKEN ENVINEYSSILEDQRLYIDETVNDN IPLNLRVLR SILEDLRSKIQKLESDISAQMEYCRTPCTVSCNIP VVSGKECEEIIRKGGE TSEMYLIQPDTSIKPYRV YCDMKTENGGWTVIQNRQDGSVDFGRKWDPYKKGF GNIATNE DAKKYCGLPGEYWLGNDKISQLTRMGP TELLIEMEDWKGDKVKAHYGGFTVQNEASKYQV S VNKYKGTAGNALMDGASQLVGENRTMTIHNGMFFS TYDRDNDGWVTTDPRKQCSKEDGG GWWYNRCHAA NPNGRYYWGGLYSWDMSKHGTDDGVVWMNWKGSWY SMRRMSMKIRPFFPQ Q G Chain - MSWSLQP PSFLLCCLLLLFSPTGLAYVATRDNCCILDERFGS FCPTTCGIADFLSSYQTD VDNDLRTLEDILFRAE NRTTEAKELIKAIQVYYNPDQPPKPGMIDSATQKS KKMVEEIVK YEALLLTHETSIRYLQEIYNSNNQK ITNLKQKVAQLEAQCQEPCKDSVQIHDTTGKDCQE IANKGAKESGLYFIRPLKAKQQFLVYCEIDGSGN GWTVLQKRIDGSLDFKKNWIQYKEGF GHLSPTGT TEFWLGNEKIHLISMQSTIPYALRIQLKDWNGRTS TADYAMFRVGPESDKYR LTYAYFIGGDAGDAFDG YDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCA EQDGSGWW MNKCHAGHLNGVYHQGGTYSKSSTTN GFDDGIIWATWKSRWYSMKETTMKIIPFNRLSIG EGQQHHMGGSKQAGDV
Storage
-60C or below
Associated Disease
Blood Disorder, Cardiac
Entrez Gene
14161, 110135, 99571
Omim
-
Swiss Prot
E9PV24, Q8K0E8, Q8VCM7
Unigene
Mm.88793, Mm.30063, Mm.16422
Molecular Weight
340 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close