Plasminogen, Murine

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Mouse
Amount 1mg
Host Murine
ArtNr PP12031
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
Liquid in 50 mM Tris-HCl/0.1 M NaCl/pH 7.4
Sequence
MDHKEVILLFLLLLKPGQGDSLDGYISTQGASLFS LTKKQLAAGGVSDCLAKCEGETDFVCRSFQYHSKE QQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKT GIGNGYRGTMSRTKSGVACQKWGATFPHVPNYSPS THPNEGLEENYCRNPDNDEQGPWCYTTDPDKRYDY CNIPECEEECMYCSGEKYEGKISKTMSGLDCQAWD SQSPHAHGYIPAKFPSKNLKMNYCRNPDGEPRPWC FTTDPTKRWEYCDIPRCTTPPPPPSPTYQCLKGRG ENYRGTVSVTVSGKTCQRWSEQTPHRHNRTPENFP CKNLEENYCRNPDGETAPWCYTTDSQLRWEYCEIP SCESSASPDQSDSSVPPEEQTPVVQECYQSDGQSY RGTSSTTITGKKCQSWAAMFPHRHSKTPENFPDAG LEMNYCRNPDGDKGPWCYTTDPSVRWEYCNLKRCS ETGGSVVELPTVSQEPSGPSDSETDCMYGNGKDYR GKTAVTAAGTPCQGWAAQEPHRHSIFTPQTNPRAG LEKNYCRNPDGDVNGPWCYTTNPRKLYDYCDIPLC ASASSFECGKPQVEPKKCPGRVVGGCVANPHSWPW QISLRTRFTGQHFCGGTLIAPEWVLTAAHCLEKSS RPEFYKVILGAHEEYIRGLDVQEISVAKLILEPNN RDIALLKLSRPATITDKVIPACLPSPNYMVADRTI CYITGWGETQGTFGAGRLKEAQLPVIENKVCNRVE YLNNRVKSTELCAGQLAGGVDSCQGDSGGPLVCFE KDKYILQGVTSWGLGCARPNKPGVYVRVSRFVDWI EREMRNN
Storage
-60C or below
Associated Disease
Glomerulonephritis, Cardiovascular
Entrez Gene
18815
Omim
173350
Swiss Prot
P20918
Unigene
Mm.971
Molecular Weight
90 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close