Thrombin, Mouse

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Mouse
Amount 50ug
Host Mouse
ArtNr PT62082
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, 90% by SDS-PAGE
Presentation
50 mM sodium citrate/ 0.2 M NaCl/
0.1% PEG-8000/ pH 6.5
Sequence
TFGLGEADCGLRPLFEKKSLKDTTEKELLDSYIDG RIVEGWDAEKGIAPWQVMLFRKSPQELLCGASLIS DRWVLTAAHCILYPPWDKNFTENDLLVRIGKHSRT RYERNVEKISMLEKIYVHPRYNWRENLDRDIALLK LKKPVPFSDYIHPVCLPDKQTVTSLLRAGYKGRVT GWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCK ASTRIRITDNMFCAGFKVNDTKRGDACEGDSGGPF VMKSPFNNRWYQMGIVSWGEGCDRKGKYGFYTHVF RLKRWIQKVIDQFG
Storage
-60C or below
Associated Disease
Blood Disorder
Entrez Gene
14061
Omim
176930
Swiss Prot
P19221
Unigene
Mm.89048
Molecular Weight
34 kDa
Amount: 50ug
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Instruction sheet

PT62082.pdf