Apotransferrin, Rat

Manufacturer Assaypro
Category Products / Proteins
Type Proteins
Specific against Rat
Amount 1mg
Host Rat
ArtNr PA60151
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Purity
>, =95% by SDS-PAGE
Presentation
Lyophilized from 20 mM NaH2PO4, pH 7.4, 150 mM NaCl
Sequence
VPDKTVKWCAVSEHENTKCISFRDHMKTVLPADGP RLACVKKTSYQDCIKAISGGEADAITLDGGWVYDA GLTPNNLKPVAAEFYGSLEHPQTHYLAVAVVKKGT DFQLNQLQGKKSCHTGLGRSAGWIIPIGLLFCNLP EPRKPLEKAVASFFSGSCVPCADPVAFPQLCQLCP GCGCSPTQPFFGYVGAFKCLRDGGGDVAFVKHTTI FEVLPQKADRDQYELLCLDNTRKPVDQYEDCYLAR IPSHAVVARNGDGKEDLIWEILKVAQEHFGKGKSK DFQLFGSPLGKDLLFKDSAFGLLRVPPRMDYRLYL GHSYVTAIRNQREGVCPEGSIDSAPVKWCALSHQE RAKCDEWSVSSNGQIECESAESTEDCIDKIVNGEA DAMSLDGGHAYIAGQCGLVPVMAENYDISSCTNPQ SDVFPKGYYAVAVVKASDSSINWNNLKGKKSCHTG VDRTAGWNIPMGLLFSRINHCKFDEFFSQGCAPGY KKNSTLCDLCIGPAKCAPNNREGYNGYTGAFQCLV EKGDVAFVKHQTVLENTNGKNTAAWAKDLKQEDFQ LLCPDGTKKPVTEFATCHLAQAPNHVVVSRKEKAA RVSTVLTAQKDLFWKGDKDCTGNFCLFRSSTKDLL FRDDTKCLTKLPEGTTYEEYLGAEYLQAVGNIRKC STSRLLEACTFHKS
Storage
-60C or below
Associated Disease
Cardiovascular
Entrez Gene
24825
Omim
190000
Swiss Prot
P12346
Unigene
Rn.91296
Molecular Weight
78 kDa
Amount: 1mg
Available: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Technische Fragen zu diesem Produkt?


Salesmanager: Arne Pelz

Email: sales@hoelzel.de

Close