Comparison

Recombinant Guinea pig Cytotoxic T-lymphocyte associated protein 4 (CTLA4), partial (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Guinea Pig
Amount 50ug
Item no. BM-RPC26958-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
CTLA4
Alternative Names
Cytotoxic T-lymphocyte protein 4, Cytotoxic T-lymphocyte-associated antigen 4, CTLA-4, CD152, CTLA4
Uniprot
H0VUB1
Source
Yeast
Expression Region
37-161aa
AA Sequence
AMHVAQPAVVLASSRGVASFECEYASSHNANEVRV TVLQQVASRTTEICAATYTVERELAFPEDSACAGT SSGTRVNLTIQGLRAADTGLYICKVELMYPPPYFV GTGNGTQIYVIDPEPCPDSD
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
14.1 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Mouse B7-1 in functional ELISA is less than 0.4 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Cytotoxic Tlymphocyte 4(CTLA-4, CD152), is a type I transmembrane T cell inhibitory molecule that is a member of the Ig superfamily.CD28 and CTLA-4, together with their ligands, B7-1 and B7-2, constitute one of the dominant costimulatory pathways that regulate T and B cell responses. CD28 and CTLA-4 are structurally homologous molecules that are members of the immunoglobulin (Ig) gene superfamily. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found in regulatory T Cells and may play an important role in their functions. Tcell activation through the Tcell receptor and CD28 leads to increased expression of CTLA4.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close