Comparison

Recombinant Human Fibroblast growth factor 17 (FGF17) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26836-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
FGF17
Alternative Names
Fibroblast Growth Factor 17, FGF-17, FGF17
Uniprot
O60258
Source
E.coli
Expression Region
23-216aa
AA Sequence
TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQL YSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDT FGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDC VFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQA SRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEF VGSAPTRRTKRTRRPQPLT
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
22.6 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells is less than 3 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Fibroblast Growth Factor 17 (FGF17) is a member of the heparin-binding growth factors family that is prominently expressed in the cerebellum and cortex. Proteins of this family possess broad mitogenic and cell survival activities and they are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF17 plays an important role in the regulation of embryonic development and it acts as signaling molecule in the induction and patterning of the embryonic brain. In addition, FGF17 stimulates the proliferation and activation of cells that express FGF receptors.
Function
Plays an important role in the regulation of embryonic development and as signaling molecule in the induction and patterning of the embryonic brain. Required for normal brain development.
Involvement in disease
Hypogonadotropic hypogonadism 20 with or without anosmia (HH20)
Subcellular location
Secreted
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Preferentially expressed in the embryonic brain.
Paythway
MAPKsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close