Comparison

Recombinant Human Fibroblast growth factor 7 (FGF7) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26839-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
FGF7
Alternative Names
Fibroblast growth factor 7, FGF-7, Heparin-binding growth factor 7, HBGF-7, Keratinocyte growth factor, FGF7, KGF
Uniprot
P21781
Source
E.coli
Expression Region
32-194aa
AA Sequence
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRV RRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIR TVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNED CNFKELILENHYNTYASAKWTHNGGEMFVALNQKG IPVRGKKTKKEQKTAHFLPMAIT
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
19.1 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 8.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human FGFR3 in functional ELISA is less than 5 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Fibroblast growth factor 7 (FGF7) is a secreted protein which is mainly located in epithelial cells and belongs to the heparin-binding growth factors family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF7 is a potent epithelial cell-specific growth factor, whose mitogenic activity is predominantly exhibited in keratinocytes but not in fibroblasts and endothelial cells. It is possible major paracrine effector of normal epithelial cell proliferation.
Function
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
Subcellular location
Secreted
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Epithelial cell.
Paythway
MAPKsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close