Comparison

Recombinant Human Beta-nerve growth facto r(NGF), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26841-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
NGF
Alternative Names
Beta-Nerve Growth Factor, Beta-NGF, NGF, NGFB
Uniprot
P01138
Source
Mammalian cell
Expression Region
122-239aa
AA Sequence
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKE VMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRG IDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRID TACVCVLSRKAVR
Sequence Info
Partial
Tag Info
Tag-Free
Theoretical MW
13.5 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 250 mM NaCl, pH 7.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 2 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Human beta-Nerve Growth Factor (beta-NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits alpha, beta, and gamma; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. beta-NGF is a neurotrophic factor that signals through its receptor beta-NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta-NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta-NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
Function
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI
Involvement in disease
Neuropathy, hereditary sensory and autonomic, 5 (HSAN5)
Subcellular location
Secreted
Protein Families
NGF-beta family
Paythway
MAPKsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close