Comparison

Recombinant Human Transforming growth factor beta-2 proprotein (TGFB2), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26842-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
TGFB2
Alternative Names
Transforming growth factor beta-2, TGFB2, Polyergin, G-TSF, Glioblastoma-derived T-cell suppressor factor, Cetermin, BSC-1 cell growth inhibitor, TGF-beta-2
Uniprot
P61812
Source
Mammalian cell
Expression Region
303-414aa
AA Sequence
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHE PKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINP EASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMI VKSCKCS
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
12.7 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um Filtered 4 mM HCl
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is less than 15 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Transforming growth factor beta-2 (TGF-beta2) is a secreted protein which belongs to the TGF-beta family. It is known as a cytokine that performs many cellular functions and has a vital role during embryonic development. The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive. It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. Defects in TGFB2 may be a cause of non-syndromic aortic disease (NSAD).
Function
TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
Involvement in disease
Loeys-Dietz syndrome 4 (LDS4)
Subcellular location
Secreted
Protein Families
TGF-beta family
Paythway
Hipposignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close