Comparison

Recombinant Human Thrombopoietin (THPO) (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26843-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
THPO
Alternative Names
Thrombopoietin, C-mpl ligand, Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor, Myeloproliferative leukemia virus oncogene ligand, THPO
Uniprot
P40225
Source
Mammalian cell
Expression Region
22-353aa
AA Sequence
SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPL PTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLL LEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQ SLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVR FLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELP NRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPG LLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSR RTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPT GQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS PLLNTSYTHSQNLSQEG
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Theoretical MW
37.3 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using MO7e human megakaryocytic leukemic cells is less than 10 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Thrombopoietin (TPO) is a glycoprotein hormone which belongs to the EPO/TPO family. It produced by the liver and kidney which regulates the production of platelets. TPO stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Lineage-specific cytokine affects the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Function
Lineage-specific cytokine affecting the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets.
Involvement in disease
Thrombocythemia 1 (THCYT1)
Subcellular location
Secreted
Protein Families
EPO/TPO family
Paythway
Jak-STATsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close