Comparison

Recombinant Human Leukemia inhibitory factor (LIF) (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26846-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
LIF
Alternative Names
Leukemia Inhibitory Factor, LIF, Differentiation-Stimulating Factor, D Factor, Melanoma-Derived LPL Inhibitor, MLPLI, Emfilermin, LIF, HILDA
Uniprot
P15018
Source
E.coli
Expression Region
23-202aa
AA Sequence
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNG SANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPF HANGTEKAKLVELYRIVVYLGTSLGNITRDQKILN PSALSLHSKLNATADILRGLLSNVLCRLCSKYHVG HVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAV LAQAF
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
19.7 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, 0.02% Tween 20, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by the M1 cell differentiation assay is less than 0.8 ng/ml
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Leukemia Inhibitory Factor (LIF) is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. LIF has a number of other activities including cholinergic neuron differentiation, control of stem cell pluripotency, bone and fat metabolism, mitogenesis of certain factor dependent cell lines and promotion of megakaryocyte production in vivo. Human and murine mature LIF exhibit a 78% sequence identity at the amino acid level. Human LIF is equally active on human and mouse cells. Murine LIF is approximately 1000 fold less active on human cells than human LIF.
Function
LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
Subcellular location
Secreted
Protein Families
LIF/OSM family
Paythway
Jak-STATsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close