Comparison

Recombinant Human Fibroblast growth factor 12 (FGF12) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26848-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
FGF12
Alternative Names
Fibroblast Growth Factor 12, FGF-12, Fibroblast Growth Factor Homologous Factor 1, FHF-1, Myocyte-Activating Factor, FGF12, FGF12B, FHF1
Uniprot
P61328-2
Source
E.coli
Expression Region
1-181aa
AA Sequence
MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTK DENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGE GYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQ ESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKP IEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKV VNQDST
Sequence Info
Full Length of Isoform 2
Tag Info
Tag-Free
Theoretical MW
20.45 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, 5 mM EDTA, pH 7.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human FGF R3 in functional ELISA is less than 20 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Fibroblast Growth Factor 12 (FGF-12) is a member of the fibroblast growth factor (FGF) family. FGF-12 is probably involved in nervous system development and function. FGF-12 lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfectedinto mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close