Comparison

Recombinant Human Transforming growth factor beta-3 (TGFB3), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26851-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
TGFB3
Alternative Names
Transforming growth factor beta-3, TGFB3, TGF-beta-3, Latency-associated peptide, LAP
Uniprot
P10600
Source
Mammalian cell
Expression Region
301-412aa(Y340F)
AA Sequence
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHE PKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNP EASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMV VKSCKCS
Sequence Info
Partial
Tag Info
Tag-Free
Theoretical MW
12.7 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um Filtered 4 mM HCl
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit the IL-4-dependent proliferation of TF-1 mouse T cells is less than 2 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Transforming growth factor beta 3(TGFB3) is a member of a TGF -beta superfamily which is defined by theirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset ofintegrins. It binds with high affinity to TGF- beta RII, a type II serine/threonine kinase receptor. TGFB3 is involved incell differentiation, embryogenesis and development.It is believed to regulate molecules involved in cellularadhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF-beta3, mammals develop a deformity known as a cleft palate.
Function
Involved in embryogenesis and cell differentiation.
Involvement in disease
Arrhythmogenic right ventricular dysplasia, familial, 1 (ARVD1); Loeys-Dietz syndrome 5 (LDS5)
Subcellular location
Secreted
Protein Families
TGF-beta family
Paythway
Hipposignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close