Comparison

Recombinant Human Interferon alpha-2 (IFNA2) (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26867-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
IFNA2
Alternative Names
Interferon Alpha-2, IFN-Alpha-2, Interferon Alpha-A, LeIF A, IFNA2
Uniprot
P01563
Source
E.coli
Expression Region
24-188aa
AA Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHD FGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTK DSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGV TETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAW EVVRAEIMRSFSLSTNLQESLRSKE
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
19.24 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by a viral resistance assay using VSV-WISH cells is typically 10 pg/mL.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
At least 23 different variants of IFN-alpha are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN-alpha subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN-alpha subtypes only differ in their sequences by one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxy-terminal end.
Function
Produced by macrophages, IFN-alpha have antiviral activities.
Subcellular location
Secreted
Protein Families
Alpha/beta interferon family
Paythway
Jak-STATsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close