Comparison

Recombinant Human Interleukin-18 (IL18) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26869-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
IL18
Alternative Names
Interleukin-18, Iboctadekin, Interferon gamma-inducing factor, IFN-gamma-inducing factor, Interleukin-1 gamma, IL-1 gamma, GIF, IL-18, IL-1g, IL1F4, MGC12320
Uniprot
Q14116
Source
E.coli
Expression Region
37-193aa
AA Sequence
YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTD SDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEK ISTLSCENKIISFKEMNPPDNIKDTKSDIIFFQRS VPGHDNKMQFESSSYEGYFLACEKERDLFKLILKK EDELGDRSIMFTVQNED
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
18.2 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to induce NFKB reporter gene expression in HEK 293 cell line is less than 25ng/mL.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Interleukin-18 is a secreted protein and it belongs to the IL-1 family. IL-18 is a proinflammatory cytokine and produced by macrophages and other cells. This cytokine can induce the IFN-gamma production of T cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production of B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity. After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-gamma (IFN-gamma) or type II interferon that plays an important role in activating the macrophages or other cells.
Function
Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.
Subcellular location
Secreted
Protein Families
IL-1 family
Paythway
InflammasomeSignaling

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close