Comparison

Recombinant Human Interferon gamma (IFNG) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26870-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
IFNG
Alternative Names
Interferon Gamma, IFN-Gamma, Immune Interferon, IFNG
Uniprot
P01579
Source
Mammalian cell
Expression Region
24-166aa
AA Sequence
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKN WKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSV ETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNV QRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRR ASQ
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
16.8 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Specific activity as determined by a viral resistance assay using VSV-WISH cells is greater than 1.5 x 10^7 IU/mg.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
IFNgamma is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them, leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNgamma synthesis is induced by IL-2, FGF-basic, and EGF.
Function
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Involvement in disease
Aplastic anemia (AA)
Subcellular location
Secreted
Protein Families
Type II (or gamma) interferon family
Tissue Specificity
Released primarily from activated T lymphocytes.
Paythway
HIF-1signalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close