Comparison

Recombinant Human Interleukin-1 alpha (IL1A) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 1mg
Item no. BM-RPC26872-1mg
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
IL1A
Alternative Names
Interleukin-1 Alpha, IL-1 Alpha, Hematopoietin-1, IL1A, IL1F1
Uniprot
P01583
Source
E.coli
Expression Region
113-271aa
AA Sequence
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRA NDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITV ILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGS ETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWV CLAGGPPSITDFQILENQA
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
18 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to induce NFKB reporter gene expression in HEK 293 cell line is less than 50 pg/mL.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Interleukin-1 alpha (IL1alpha) is a cytokine member of the interleukin-1 family. IL-1 consists of two distinct forms: IL1alpha and IL1beta that recognize the same cell surface receptors but are distinct proteins with approximately 25% amino acid sequence identity. IL1alpha is constitutively produced by epithelial cells and plays an essential role in maintenance of skin barrier function. Upon stimulation, a wide variety of cells including osteoblasts, monocytes, macrophages can be induced to express IL1alpha. IL1alpha possesses a wide range of metabolic, physiological, haematopoietic activities, and is critically involved in the regulation of the immune responses and inflammatory responses.
Function
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Subcellular location
Secreted
Protein Families
IL-1 family
Paythway
MAPKsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 1mg
Available: In stock
available
Questions about this Product?
 
Close