Comparison

Recombinant Human Tumor necrosis factor ligand superfamily member 10 (TNFSF10), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26936-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
TNFSF10
Alternative Names
Tumor Necrosis Factor Ligand Superfamily Member 10, Apo-2 Ligand, Apo-2L, TNF-Related Apoptosis-Inducing Ligand, Protein TRAIL, CD253, TNFSF10, APO2L, TRAIL
Uniprot
P50591
Source
E.coli
Expression Region
115-281aa
AA Sequence
RERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGR KINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYI YSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDP ILLMKSARNSCWSKDAEYGLYSIYQGGIFELKEND RIFVSVTNEHLIDMDHEASFFGAFLVG
Sequence Info
Partial
Tag Info
Tag-Free
Theoretical MW
19.5 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um Filtered 150 mM NaCl
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is less than 50 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Human TNFSF10 is a type II transmembrane protein with an intracellular N-terminus and a ´TNF homology domain´ (THD) at the extracellular C terminus. TNFSF10 can interact with several distinct receptors. Two of these receptors that belongs to TNFR superfamily, DR4 (TRAIL-R1) and DR5 (TRAIL-R2/TRICK2), are plasma membrane proteins containing intracellular death domains essential for activating apoptosis. TNFSF10 is promising for cancer therapy because it is cytotoxic and activates apoptosis in the majority of malignant cells, but not in normal cells.
Function
Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG
Subcellular location
Membrane, Single-pass type II membrane protein
Protein Families
Tumor necrosis factor family
Tissue Specificity
Widespread; most predominant in spleen, lung and prostate.
Paythway
Apoptosis

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close