Comparison

Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26938-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
TNFRSF10B
Alternative Names
Tumor Necrosis Factor Receptor Superfamily Member 10B, Death Receptor 5, TNF-Related Apoptosis-Inducing Ligand Receptor 2, TRAIL Receptor 2, TRAIL-R2, CD262, TNFRSF10B, DR5, KILLER, TRAILR2, TRICK2, ZTNFR9
Uniprot
O14763
Source
Mammalian cell
Expression Region
56-182aa
AA Sequence
ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISED GRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVE LSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGC PRGMVKVGDCTPWSDIECVHKE
Sequence Info
Partial
Tag Info
C-terminal 6xHis-FC-tagged
Theoretical MW
42.2 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L?929 mouse fibroblast cells treated with TRAIL is typically 23 ng/mL.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
TNFRSF10B is a member of the TNF-receptor superfamily, and contains an intracellular death domain. This receptor can be activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL/APO-2L), and transduces apoptosis signal. The adapter molecule FADD recruits caspase-8 to the activated receptor and is required for the apoptosis mediated by TNFRSF10B. TNFRSF10B is expressed in a number of cell types, and to particularly high levels in lymphocytes and spleen. This single-pass transmembrane protein contains two cysteine-rich repeat units in its extracellular region, followed by a transmembrane segment and a cytoplasmic tail containing a typical "death domain". TNFRSF10B expression is regulated by the tumor suppressor p53. It is also indicated that the activation of NF-kappa-B can be promoted by TNFRSF10B.
Function
Receptor for the cytotoxic ligand TNFSF10/TRAIL
Involvement in disease
Squamous cell carcinoma of the head and neck (HNSCC)
Subcellular location
Membrane, Single-pass type I membrane protein
Tissue Specificity
Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLaS3, K-562, HL-60, SW480, A-549 and G-361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, prostate, ovary, uterus, placenta, testis, esophagus, stomach and throughout the intestinal tract; not detectable in brain.
Paythway
p53signalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close