Comparison

Recombinant Human Lymphotoxin-alpha (LTA) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26940-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
LTA
Alternative Names
Lymphotoxin-Alpha, LT-Alpha, TNF-Beta, Tumor Necrosis Factor Ligand Superfamily Member 1, LTA, TNFB, TNFSF1
Uniprot
P01374
Source
E.coli
Expression Region
35-205aa
AA Sequence
LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIG DPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTS GIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFS SQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQ LTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Sequence Info
Full Length of Mature Protein
Tag Info
Tag-Free
Theoretical MW
18.8 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cytotoxicity assay using L?929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D is less than 100 pg/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Tumor Necrosis Factor beta (TNF-beta) is a secreted protein belonging to the tumor necrosis factor family. TNF-beta binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM in homotrimeric form, binds to TNFRSF3/LTBR in heterotrimeric form with LTB. TNF-beta forms heterotrimers with lymphotoxin-beta, which anchors TNF-beta to the cell surface. TNF-beta mediates the inflammatory, immunostimulatory, and antiviral response, involves in the formation of second lymphoid organs during development, has a role in apoptosis. TNF-beta is produced by lymphocytes and cytotoxic for a variety of tumor cells in vitro and in vivo.
Function
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo.
Involvement in disease
Psoriatic arthritis (PSORAS)
Subcellular location
Secreted, Membrane
Protein Families
Tumor necrosis factor family
Paythway
NF-kappaBsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close