Comparison

Recombinant Human Tumor necrosis factor receptor superfamily member 11B (TNFRSF11B) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26941-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
TNFRSF11B
Alternative Names
Tumor Necrosis Factor Receptor Superfamily Member 11B, Osteoclastogenesis Inhibitory Factor, Osteoprotegerin, TNFRSF11B, OCIF, OPG
Uniprot
O00300
Source
Mammalian cell
Expression Region
22-401aa
AA Sequence
ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTA KWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQ YVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPP GFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCR KHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCG IDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTK VNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDI VKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMES LPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKN GDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRF LHSFTMYKLYQKLFLEMIGNQVQSVKISCL
Sequence Info
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
44.65 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L?929 mouse fibroblast cells treated with TRAIL is less than 25 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
TNFRSF11B is a secreted protein, containing 2 death domains and 4 TNFR-Cys repeats. TNFRSF11B is a decoy receptor for the receptor activator of nuclear factor kappa B ligand (RANKL). By binding RANKL, TNFRSF11B inhibits nuclear kappa B (NF-kappaB) which is a central and rapid acting transcription factor for immune-related genes, and a key regulator of inflammation, innate immunity, and cell survival and differentiation. TNFRSF11B levels are influenced by voltage-dependent calcium channelsCav1.2. TNFRSF11B can reduce the production of osteoclasts by inhibiting the differentiation of osteoclast precursors (osteoclasts are related to monocytes/macrophages and are derived from granulocyte/macrophage-forming colony units (CFU-GM)) into osteoclasts and also regulates the resorption of osteoclasts in vitroand in vivo. TNFRSF11B binding to RANKL on osteoblast/stromal cells, blocks the RANKL-RANK ligand interaction between osteoblast/stromal cells and osteoclast precursors. This has the effect of inhibiting the differentiation of the osteoclast precursor into a mature osteoclast.
Function
Acts as decoy receptor for TNFSF11/RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local ratio between TNFSF11 and TNFRSF11B. May also play a role in preventing arterial calcification. May act as decoy receptor for TNFSF10/TRAIL and protect against apoptosis. TNFSF10/TRAIL binding blocks the inhibition of osteoclastogenesis.
Involvement in disease
Paget disease of bone 5, juvenile-onset (PDB5)
Subcellular location
Secreted
Tissue Specificity
Highly expressed in adult lung, heart, kidney, liver, spleen, thymus, prostate, ovary, small intestine, thyroid, lymph node, trachea, adrenal gland, testis, and bone marrow. Detected at very low levels in brain, placenta and skeletal muscle. Highly expressed in fetal kidney, liver and lung.
Paythway
Osteoclastdifferentiation

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close