Comparison

Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26943-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
TNFRSF1A
Alternative Names
Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, TNF-R1, Tumor necrosis factor receptor type I, TNF-RI, TNFR-I, TNFAR, TNFR1
Uniprot
P19438
Source
E.coli
Expression Region
22-211aa
AA Sequence
IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNS ICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTA SENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCG CRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEK QNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCL PQIENVKGTEDSGTT
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
Theoretical MW
23.5 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L?929 mouse fibroblast cells is less than 500 ng/ml in the presence of the metabolic inhibitor actinomycin D.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) is a member of the tumor necrosis factor receptor superfamily. Tnfrsf1a is one of the major receptors for the tumor necrosis factor-alpha. It can activate the transcription factor NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the human genetic disorder called tumor necrosis factor associated periodic syndrome (TRAPS) or periodic fever syndrome
Function
Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
Involvement in disease
Familial hibernian fever (FHF); Multiple sclerosis 5 (MS5)
Subcellular location
Cell membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Secreted, Note=A secreted form is produced through proteolytic processing, SUBCELLULAR LOCATION: Isoform 4: Secreted
Paythway
MAPKsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close