Comparison

Recombinant Human Tumor necrosis factor receptor superfamily member 10C (TNFRSF10C), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26944-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
TNFRSF10C
Alternative Names
Tumor Necrosis Factor Receptor Superfamily Member 10C, Antagonist Decoy Receptor for TRAIL/Apo-2L, Decoy TRAIL Receptor Without Death Domain, Decoy Receptor 1, DcR1, Lymphocyte Inhibitor of TRAIL, TNF-Related Apoptosis-Inducing Ligand Receptor 3, TRAIL Receptor 3, TRAIL-R3, TRAIL Receptor Without an Intracellular Domain, CD263, TNFRSF10C, DCR1, LIT, TRAILR3, TRID
Uniprot
O14798
Source
Mammalian cell
Expression Region
26-221aa
AA Sequence
ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRS EHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQ KHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSR CPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAE ETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTT SPGTPAPAAEETMTTSPGTPA
Sequence Info
Partial
Tag Info
C-terminal 6xHis-FC-tagged
Theoretical MW
48.7 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L?929 mouse fibroblast cells treated with TRAIL is typically 450 ng/mL.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) is a glycosyl-phosphatidylinositol-linked membrane protein which binds TRAIL with high affinity. TNFRSF10C has the TRAIL-binding extracellular cysteine-rich domains, lacks the intracellular signaling domain. As a result, binding of TRAIL to TRAIL R3 doesn´t transduce an apoptosis signal. The expression of TRAIL R3 gene has been shown to protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL-induced apoptosis.
Function
Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis by competing with TRAIL-R1 and R2 for binding to the ligand.
Subcellular location
Cell membrane, Lipid-anchor, GPI-anchor
Tissue Specificity
Higher expression in normal tissues than in tumor cell lines. Highly expressed in peripheral blood lymphocytes, spleen, skeletal muscle, placenta, lung and heart.
Paythway
Apoptosis

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close