Comparison

Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26945-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
TNFSF15
Alternative Names
Tumor Necrosis Factor Ligand Superfamily Member 15, TNF Ligand-Related Molecule 1, Vascular Endothelial Cell Growth Inhibitor, TNFSF15, TL1, VEGI
Uniprot
O95150-2
Source
E.coli
Expression Region
1-192aa
AA Sequence
MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDK PRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTK NRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSE IRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTK SVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDIS LVDYTKEDKTFFGAFLL
Sequence Info
Full Length of Isoform 2
Tag Info
Tag-Free
Theoretical MW
21.86 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 250 mM NaCl, pH 7.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using HUVEC cells is typically 5 ug/mL.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Tumor Necrosis Factor Ligand Superfamily Member 15 (TNFSF15) is a new member of the tumor necrosis factor family. TNFSF15 is predominantly an endothelial cell-specific gene, and recombinant TNFSF15 is a potent inhibitor of endothelial cell proliferation, angiogenesis and tumor growth. TNFSF15 exerts two activities on endothelial cells: early G1 arrest of G0/G1-cells responding to growth stimuli and programmed cell death of proliferating cells. These activities are highly specific to endothelial cells. TNFSF15 is also able to regulate the expression of several important genes involved in angiogenesis. These findings are consistent with the view that TNFSF15 functions as an autocrine cytokine to inhibit angiogenesis and stabilize the vasculature.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close