Comparison

Recombinant Human 5'-nucleotidase (NT5E), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26953-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
NT5E
Alternative Names
5'-Nucleotidase, 5'-NT, Ecto-5'-Nucleotidase, CD73, NT5E, NT5, NTE
Uniprot
P21589
Source
Mammalian cell
Expression Region
27-547aa
AA Sequence
WELTILHTNDVHSRLEQTSEDSSKCVNASRCMGGV ARLFTKVQQIRRAEPNVLLLDAGDQYQGTIWFTVY KGAEVAHFMNALRYDAMALGNHEFDNGVEGLIEPL LKEAKFPILSANIKAKGPLASQISGLYLPYKVLPV GDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQ PEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGV DVVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTSDD GRKVPVVQAYAFGKYLGYLKIEFDERGNVISSHGN PILLNSSIPEDPSIKADINKWRIKLDNYSTQELGK TIVYLDGSSQSCRFRECNMGNLICDAMINNNLRHT DEMFWNHVSMCILNGGGIRSPIDERNNGTITWENL AAVLPFGGTFDLVQLKGSTLKKAFEHSVHRYGQST GEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRV PSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELL RHDSGDQDINVVSTYISKMKVIYPAVEGRIK
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
58.76 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 20 mM Tris-HCl, 120 mM NaCl, 4 mM CaCl2, 20% Glycerol, pH 7.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Specific activity as determined by its ability to hydrolyze the 5´-phosphate group from the substrate adenosine-5´-monophosphate (AMP) is greater than 15000 pmol/min/ug. The orthophosphate product is measured by a malachite green phosphate detection kit.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
CD73 is a glycosyl phosphatidylinositol (GPI) anchored membrane protein that belongs to the 5'-nucleotidase family. CD73 is an ecto 5'Nucleotidase expressed by most cell types. CD73 hydrolyzes extracellular nucleotides into membrane permeable nucleosides. CD73 is one of several enzymes responsible for the production of extracellular adenosine, a signaling molecule that is involved in responses to inflammation and tissue injury. CD73 is a lymphocyte maturation marker that has functions independent of its catalytic activity. CD73 is also a regulator of leukocyte extravasation, a function that requires its 5'Nucleotidase activity. Defects in NT5E are the cause of calcification of joints and arteries (CAJA). The recombinant CD73 lacking GPI anchor is secreted as a monomer.
Function
Hydrolyzes extracellular nucleotides into membrane permeable nucleosides. Exhibits AMP-, NAD-, and NMN-nucleosidase activities.
Involvement in disease
Calcification of joints and arteries (CALJA)
Subcellular location
Cell membrane, Lipid-anchor, GPI-anchor
Protein Families
5'-nucleotidase family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close