Comparison

Recombinant Human Nectin-2 (NECTIN2), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26954-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
NECTIN2
Alternative Names
Poliovirus Receptor-Related Protein 2, Herpes Virus Entry Mediator B, Herpesvirus Entry Mediator B, HveB, Nectin-2, CD112, PVRL2, HVEB, PRR2
Uniprot
Q92692
Source
Mammalian cell
Expression Region
32-360aa
AA Sequence
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYIS LVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSE RLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEG NYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKV TFSQDPTTVALCISKEGRPPARISWLSSLDWEAKE TQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVE HESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGR TDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQG SQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFV RETPNTAGAGATGG
Sequence Info
Extracellular Domain
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
36.58 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human DNAM-1 in functional ELISA is less than 10 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
CD112 is a type I transmembrane glycoprotein belonging to the Immunoglobulin superfamily. It comprises one Ig-like V-type domain and two Ig-like C2-type domains in the extracellular region. The V domain is believed to mediate nectin binding to its ligands. Nectin2 is known to bind the pseudorabies virus, and herpes simplex virus2 (HSV2), involving in cell to cell spreading of these viruses. It does not bind poliovirus. As a homophilic adhesion molecule, CD112 is found concentrated in adherens junctions, and exists on neurons, endothelial cells, epithelial cells and fibroblasts. CD112 has been identified as the ligand for DNAM-1 (CD226), and the interaction of CD226/CD112 mediates cytotoxicity and cytokine secretion by T and NK cells. The costimulatory responses may be a critical component in allergic reactions and may therefore become targets for anti-allergic therapy.
Function
Modulator of T-cell signaling. Can be either a costimulator of T-cell function, or a coinhibitor, depending on the receptor it binds to. Upon binding to CD226, stimulates T-cell proliferation and cytokine production, including that of IL2, IL5, IL10, IL13, and IFNG. Upon interaction with PVRIG, inhibits T-cell proliferation. These interactions are competitive
Subcellular location
Cell membrane, Single-pass type I membrane protein
Protein Families
Nectin family
Tissue Specificity
Ubiquitous.
Paythway
Adherensjunction

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close