Comparison

Recombinant Human Lysosome-associated membrane glycoprotein 1 (LAMP1), partial (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26955-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
LAMP1
Alternative Names
Lysosome-Associated Membrane Glycoprotein 1, LAMP-1, Lysosome-Associated Membrane Protein 1, CD107 Antigen-Like Family Member A, CD107a, LAMP1
Uniprot
P11279
Source
Mammalian cell
Expression Region
29-382aa
AA Sequence
AMFMVKNGNGTACIMANFSAAFSVNYDTKSGPKNM TFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGH TLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASS KEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTV TLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPP APPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGL QLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHL VTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNT ILPDARDPAFKAANGSLRALQATVGNSYKCNAEEH VRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLD ENSM
Sequence Info
Partial
Tag Info
C-terminal FC-tagged
Theoretical MW
65.5 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human Galectin-3 in functional ELISA is less than 20 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Lysosome-Associated Membrane Glycoprotein 1 (LAMP1) is a single-pass type I membrane protein belonging to the LAMP family. LAMP1 is expressed largely in the endosome-lysosome membranes of cells.It shuttles between lysosomes, endosomes, and the plasma membrane. LAMP1 functions to present carbohydrate ligands to selectins and it has also been implicated in tumor cell metastasis. It has been proposed LAMP1 can be used as a therapeutic agent for certain cancers, as well as a marker for lysosomal storage disorders and degranulation on lymphocytes such as CD8+ and NK cells. Cell surface LAMP1 and LAMP2 have been shown to promote adhesion of human peripheral blood mononuclear cells(PBMC) to vascular endothelium, therefore they are possibly involved in the adhesion of PBMCs to the site of inflammation.
Function
Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis.; FUNCTION
Subcellular location
Cell membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein, Late endosome
Protein Families
LAMP family
Paythway
Autophagy-animal

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close