Comparison

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor III-A (FCGR3A), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26957-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
FCGR3A
Alternative Names
Low Affinity Immunoglobulin Gamma Fc Region Receptor III-A, CD16a Antigen, Fc-Gamma RIII-Alpha, Fc-Gamma RIII, Fc-gamma RIIIa, FcRIII, FcRIIIa, FcR-10, IgG Fc Receptor III-2, CD16a, FCGR3A, CD16A, FCG3, FCGR3, IGFR3
Uniprot
P08637
Source
Mammalian cell
Expression Region
17-208aa
AA Sequence
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAY SPEDNSTQWFHNESLISSQASSYFIDAATVDDSGE YRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEE DPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSD FYIPKATLKDSGSYFCRGLFGSKNVSSETVNITIT QGLAVSTISSFFPPGYQ
Sequence Info
Extracellular Domain
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
22.61 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human IGHG1 in functional ELISA is less than 20 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Receptors for the Fc region of immunoglobin G (FcgammaR) are divided into three classes and FcgammaRIII is a multifunctional, low/intermediate affinity receptor. In humans, FcgammaRIII is expressed as two distinct forms (FcgammaRIIIA and FcgammaRIIIB) that are encoded by two different but highly homologous genes in a cell type-specific manner. FcgammaRIIIB is a low-affinity, GPI-linked receptor expressed by neutrophils and eosinophils, whereas FcgammaRIIIA is an intermediate affinity polypeptide-anchored transmembrane glycoprotein expressed by a subset of T lymphocytes, natural killer (NK) cells, monocytes, and macrophages. The FcgammaRIIIA receptor is involved in phagocytosis, secretion of enzymes, inflammatory mediators, antibody-dependent cellular cytotoxicity (ADCC), mast cell degranulation, and clearance of immune complexes. FcgammaRIIIA has an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain and delivers an activation signal in the immune responses. Aberrant expression or mutations in this gene is implicated in susceptibility to recurrent viral infections, systemic lupus erythematosus, and alloimmune neonatal neutropenia. In humans, it is a 50 -70 kD type I transmembrane activating receptor. The FcgammaRIIIA cDNA encodes 254 amino acid including a 16aa signal sequence, 191 amino acid ECD with two C2-type Ig-like domains, five potential N-glycosylation sites, a 22 amino acid transmembrane sequence and a 25 amino acid cytoplasmic domain.
Function
Receptor for the Fc region of IgG. Binds complexed or aggregated IgG and also monomeric IgG. Mediates antibody-dependent cellular cytotoxicity (ADCC) and other antibody-dependent responses, such as phagocytosis.
Involvement in disease
Immunodeficiency 20 (IMD20)
Subcellular location
Cell membrane, Single-pass type I membrane protein, Secreted
Tissue Specificity
Expressed on natural killer cells, macrophages, subpopulation of T-cells, immature thymocytes and placental trophoblasts.
Paythway
FcgammaR-mediatedphagocytosis

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close