Comparison

Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26960-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
TNFRSF9
Alternative Names
CD137, ILA, TNFRSF9, 4-1BB ligand receptor, CDw137, T-cell antigen 4-1BB homolog, T-cell antigen ILA
Uniprot
Q07011
Source
Mammalian cell
Expression Region
24-186aa
AA Sequence
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGG QRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFH CLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQ KRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPA DLSPGASSVTPPAPAREPGHSPQ
Sequence Info
Extracellular Domain
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
18.1 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human TNFSF9 in functional ELISA is less than 50 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Tumor necrosis factor receptor superfamily member 9(TNFRSF9), also known as CD137 and 4-1BB, is an inducible T cell surface protein belonging to the tumor necrosis factor receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. CD137 is expressed by mesenchymal cells, including endothelial cells, chondrocytes, and cells of the central nervous system. CD137 is also broadly expressed by cells of the human immune system, is broadly expressed by cells of the human immune system, including activated CD8+ and CD4+ T cells, activated natural killer (NK) cells, follicular dendritic cells (FDCs) and monocytes. CD137 has diverse roles in the immune response, the one key function is to promote the survival of both T cells and dendritic cells by binding the cognate ligand CD137L (4-1BBL).
Function
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.
Subcellular location
Membrane, Single-pass type I membrane protein
Tissue Specificity
Expressed on the surface of activated T-cells.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close