Comparison

Recombinant Human T-lymphocyte activation antigen CD86 (CD86), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26962-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
CD86
Alternative Names
T-Lymphocyte Activation Antigen CD86, Activation B7-2 Antigen, B70, BU63, CTLA-4 Counter-Receptor B7.2, FUN-1, CD86, CD28LG2
Uniprot
P42081
Source
Mammalian cell
Expression Region
24-247aa
AA Sequence
APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQ DQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSW TLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNS ELSVLANFSQPEIVPISNITENVYINLTCSSIHGY PEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYD VSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFS IELEDPQPPPDHIP
Sequence Info
Extracellular Domain
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
26.69 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human CTLA-4 in functional ELISA is less than 20 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
The protein is the receptor that involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. It may play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. The protein interacts with MARCH8, human herpesvirus 8 MIR2 protein, adenovirus subgroup B fiber proteins and acts as a receptor for these viruses.It is expressed by activated B-lymphocytes and monocytes and promoted by MARCH8 and results in endocytosis and lysosomal degradation.It contains 1 Ig-like C2-type(immunoglobulin-like) domainand 1 Ig-like V-type (immunoglobulin-like) domain.
Function
Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation.; FUNCTION
Subcellular location
Cell membrane, Single-pass type I membrane protein
Tissue Specificity
Expressed by activated B-lymphocytes and monocytes.
Paythway
Toll-likereceptorsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close