Comparison

Recombinant Human CD40 ligand (CD40LG), partial (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26965-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
CD40LG
Alternative Names
CD40 Ligand, CD40-L, T-Cell Antigen Gp39, TNF-Related Activation Protein, TRAP, Tumor Necrosis Factor Ligand Superfamily Member 5, CD154, CD40LG, CD40L, TNFSF5, TRAP
Uniprot
P29965
Source
E.coli
Expression Region
113-261aa
AA Sequence
MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYT MSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNRE ASSQAPFIASLCLKSPGRFERILLRAANTHSSAKP CGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTG FTSFGLLKL
Sequence Info
Partial
Tag Info
Tag-Free
Theoretical MW
16.2 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 200 mM NaCl, 0.1 mM EDTA, pH 7.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by the dose-dependent stimulation of IL-12 & IL-8 induction by PMB cells is less than 20 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
CD40 Ligand (CD40LG) is a type II transmembrane glycoprotein that belongs to the TNF superfamily. Like other TNF superfamily members, CD40LG exists as a trimer in membrane bound and soluble form, both of which are bioactive. CD40LG is a ligand for CD40; its ligation also initiates signal transduction in CD40LG expressing cells. CD40LG is a differentiation antigen that is expressed on the surface of T-cells. It stimulates B-cell proliferation and secretion of all immunoglobulin isotypes in the presence of cytokines. CD40LG has been shown to induce cytokine production and tumoricidal activity in peripheral blood monocytes. It also co-stimulates proliferation of activated T-cells and this is accompanied by the production of IFN-gamma, TNF-alpha, and IL2.
Function
Cytokine that binds to CD40/TNFRSF5
Involvement in disease
Immunodeficiency with hyper-IgM, type 1 (HIGM1)
Subcellular location
Cell membrane, Single-pass type II membrane protein, Cell surface, SUBCELLULAR LOCATION: CD40 ligand, soluble form: Secreted
Protein Families
Tumor necrosis factor family
Tissue Specificity
Specifically expressed on activated CD4+ T-lymphocytes.
Paythway
NF-kappaBsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close