Comparison

Recombinant Human CD160 antigen (CD160) (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26968-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
CD160
Alternative Names
CD160 Antigen, Natural Killer Cell Receptor BY55, CD160, BY55
Uniprot
O95971
Source
Mammalian cell
Expression Region
27-159aa
AA Sequence
INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLC KDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLM FTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSIL FTETGNYTVTGLKQRQHLEFSHNEGTLS
Sequence Info
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
15.8 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Mouse TNFRSF14 in functional ELISA is less than 50 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
CD160 antigen is a Lipid-anchor that exists as a disulfide-linked homomultimer. CD160 contains one Ig-like V-type domain. The human CD160 precursor is a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain. It is weakly homologous to KIR2DL4. CD160 is expressed in the spleen, peripheral blood, and small intestine. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules.
Function
Receptor showing broad specificity for both classical and non-classical MHC class I molecules.
Subcellular location
Cell membrane, Lipid-anchor, GPI-anchor
Tissue Specificity
Expressed in spleen, peripheral blood, and small intestine. Expression is restricted to functional NK and T cytotoxic lymphocytes.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close