Comparison

Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26970-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
TNFRSF4
Alternative Names
Tumor necrosis factor receptor superfamily member 4, TNFRSF4, OX40, CD134, Txgp1
Uniprot
P43489
Source
Mammalian cell
Expression Region
29-216aa
AA Sequence
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTV CRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQL CTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHF SPGDNQACKPWTNCTLAGKHTLQPASNSSDAICED RDPPATQPQETQGPPARPITVQPTEAWPRTSQGPS TRPVEVPGGRAVA
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
21 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human TNFSF4 in functional ELISA is less than 25 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs). The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.
Function
Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.
Involvement in disease
Immunodeficiency 16 (IMD16)
Subcellular location
Membrane, Single-pass type I membrane protein

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close