Comparison

Recombinant Human Tyrosine-protein phosphatase non-receptor type substrate 1 (SIRPA), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26973-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
SIRPA
Alternative Names
Tyrosine-Protein Phosphatase Non-Receptor Type Substrate 1, SHP Substrate 1, SHPS-1, Brain Ig-Like Molecule with Tyrosine-Based Activation Motifs, Bit, CD172 Antigen-Like Family Member A, Inhibitory Feceptor SHPS-1, Macrophage Fusion Receptor, MyD-1 Antigen, Signal-Regulatory Protein Alpha-1, Sirp-Alpha-1, Signal-Regulatory Protein Alpha-2, Sirp-Alpha-2, Signal-Regulatory Protein Alpha-3, Sirp-Alpha-3, p84, CD172a, SIRPA, BIT, MFR, MYD1, PTPNS1, SHPS1, SIRP
Uniprot
P78324
Source
Mammalian cell
Expression Region
31-370aa
AA Sequence
EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGP IQWFRGAGPGRELIYNQKEGHFPRVTTVSDLTKRN NMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFK SGAGTELSVRAKPSAPVVSGPAARATPQHTVSFTC ESHGFSPRDITLKWFKNGNELSDFQTNVDPVGESV SYSIHSTAKVVLTREDVHSQVICEVAHVTLQGDPL RGTANLSETIRVPPTLEVTQQPVRAENQVNVTCQV RKFYPQRLQLTWLENGNVSRTETASTVTENKDGTY NWMSWLLVNVSAHRDDVKLTCQVEHDGQPAVSKSH DLKVSAHPKEQGSNTAAENTGSNER
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
38.31 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human CD47 in functional ELISA is less than 0.5 ug/ml
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Signal Regulatory Protein alpha (SIRPalpha) is a monomeric approximately 90 kD type I transmembrane glycoprotein. The 504 amino acid human SIRPalpha contains two Ig-like C1-type domains and one Ig-like V-type domain. SIRPalpha can express in various tissues, mainly on brain and myeloid cells, including macrophages, neutrophils, dendritic and Langerhans cells. It also can detect in neurons, smooth muscle and endothelial cells. SIRPA is an immunoglobulin-like cell surface receptor for CD47. SIRPalpha acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. SIRPalpha shows adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. SIRPalpha engagement generally produces a negative regulatory signal; it may mediate negative regulation of phagocytosis, mast cell activation and dendritic cell activation
Function
Immunoglobulin-like cell surface receptor for CD47. Acts as docking protein and induces translocation of PTPN6, PTPN11 and other binding partners from the cytosol to the plasma membrane. Supports adhesion of cerebellar neurons, neurite outgrowth and glial cell attachment. May play a key role in intracellular signaling during synaptogenesis and in synaptic function (By similarity). Involved in the negative regulation of receptor tyrosine kinase-coupled cellular responses induced by cell adhesion, growth factors or insulin. Mediates negative regulation of phagocytosis, mast cell activation and dendritic cell activation. CD47 binding prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells.
Subcellular location
Membrane, Single-pass type I membrane protein
Tissue Specificity
Ubiquitous. Highly expressed in brain. Detected on myeloid cells, but not T-cells. Detected at lower levels in heart, placenta, lung, testis, ovary, colon, liver, small intestine, prostate, spleen, kidney, skeletal muscle and pancreas.
Paythway
Osteoclastdifferentiation

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close