Comparison

Recombinant Human Glypican-3 (GPC3), partial (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26983-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
GPC3
Alternative Names
Glypican-3, GTR2-2, Intestinal protein OCI-5, MXR7, GPC3, OCI5
Uniprot
P51654
Source
Mammalian cell
Expression Region
25-559aa
AA Sequence
QPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPG SDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQ SASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAM FKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVD DMVNELFDSLFPVIYTQLMNPGLPDSALDINECLR GARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALN LGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLM MVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLE ELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAG KLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLK VAHVEHEETLSSRRRELIQKLKSFISFYSALPGYI CSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQ FNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMP KGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMI KVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEI STFHNLGNVH
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
61.6 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human FGF Basic in functional ELISA is less than 5 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Glypican-3/GPC3 is a member of the glypican family. It belongs to the glypican family and is highly expressed in lung, liver, and kidney. It is a heparan sulfate proteoglycan, which is overexpressed in various neoplasms such as hepatocellular carcinoma, malignant melanoma, and testicular yolk sac tumor, and plays an important role in cell growth and differentiation. GPC3 function is tissue dependent. In some tissues, GPC3 acts as a tumor suppressor gene, whereas in others, it acts as an oncofetal protein. GPC3 is a reliable marker for hepatocellular carcinoma. The sensitivity and specificity exceeds both alpha-fetoprotein and hepatocyte-paraffin1. GPC3 immunohistochemistry can aid in the differentiation of testicular germ cell tumors, being expressed in all yolk sac tumors but not in seminomas. GPC3 expression has also been identified in some squamous cell carcinomas of the lung and clear cell carcinomas of the ovary. Glypican-3 is currently regarded as a tumor marker and potential target for immunotherapy.
Function
Cell surface proteoglycan that bears heparan sulfate. Inhibits the dipeptidyl peptidase activity of DPP4. May be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs. May play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. May regulate growth and tumor predisposition.
Involvement in disease
Simpson-Golabi-Behmel syndrome 1 (SGBS1)
Subcellular location
Cell membrane, Lipid-anchor, GPI-anchor, Extracellular side, SUBCELLULAR LOCATION: Secreted glypican-3: Secreted, extracellular space
Protein Families
Glypican family
Tissue Specificity
Highly expressed in lung, liver and kidney.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close