Comparison

Recombinant Human Cathepsin B (CTSB), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26984-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
CTSB
Alternative Names
Cathepsin B, APP Secretase, APPS, Cathepsin B1, CTSB, CPSB
Uniprot
P07858
Source
Mammalian cell
Expression Region
18-339aa
AA Sequence
RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDM SYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAR EQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRIC IHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAE AWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVN GSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGY NSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLY KSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVA NSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRT DQYWEKI
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
36.9 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Specific activity as determined by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC is greater than 3000 pmol/min/ug
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Cathepsin B is an enzymatic protein belonging to the peptidase (or protease) families. The protein encoded by this gene is a lysosomal cysteine protease composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. It is a member of the peptidase C1 family. At least five transcript variants encoding the same protein have been found for this gene. Cystatin-B / CSTB is an intracellular thiol proteinase inhibitor. Tightly binding reversible inhibitor of cathepsins L, H and B. Cystatin-B / CSTB is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. Cystatin-B / CSTB is also thought to play a role in protecting against the proteases leaking from lysosomes
Function
Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis.
Subcellular location
Lysosome, Melanosome, Secreted, extracellular space
Protein Families
Peptidase C1 family
Paythway
Apoptosis

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close