Comparison

Recombinant Human Carbonic anhydrase 1 (CA1) (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26985-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
CA1
Alternative Names
Carbonic Anhydrase 1, Carbonate Dehydratase I, Carbonic Anhydrase B, CAB, Carbonic Anhydrase I, CA-I, CA1
Uniprot
P00915
Source
E.coli
Expression Region
2-261aa
AA Sequence
ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKT SETKHDTSLKPISVSYNPATAKEIINVGHSFHVNF EDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGS EHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADG LAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAP FTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWI ICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNN RPTQPLKGRTVRASF
Sequence Info
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
29.93 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, 10% Glycerol, pH 8.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The esterase activity is determined to be greater than 500 pmol/min/ug
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Carbonic Anhydrase 1 (CA1) is a cytosolic enzyme, belonging to the alpha-carbonic anhydrase family. It is highly expressed in erythrocytes and acts as an early marker for erythroid differentiation. Carbonic anhydrase 1 plays a improtant role in many biological processes such as calcification, cellular respiration, bone resorption, acid-base balance. It is activated by imidazole, histamine, L-adrenaline, L- and D-histidine, and L- and D-phenylalanine. At the same time, It is inhibited by sulfonamide derivatives and coumarins. In addition, CA1 is a zinc metalloenzyme that has reversible hydration of carbon dioxide. It can hydrate cyanamide to urea.
Function
Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea.
Subcellular location
Cytoplasm
Protein Families
Alpha-carbonic anhydrase family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close