Comparison

Recombinant Human Carbonic anhydrase 13 (CA13) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26986-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
CA13
Alternative Names
Carbonic Anhydrase 13, Carbonate Dehydratase XIII, Carbonic Anhydrase XIII, CA-XIII, CA13
Uniprot
Q8N1Q1
Source
E.coli
Expression Region
1-262aa
AA Sequence
MSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIK TKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVD FDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHG SEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPD GLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQT RFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTW IVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSN HRPPQPLKGRKVRASFH
Sequence Info
Full Length
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
30.51 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The esterase activity is determined to be greater than 1000 pmol/min/ug
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Carbonic Anhydrase 13 (CA13) belongs to the carbonic anhydrase family which can catalyzes the reversible hydration recation of carbon dioxide. Carbonic anhydrases participate in many biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. CA13 is a cytosolic enzyme and is widely expressed in human, such as thymus, small intestine, spleen, prostate, ovary, colon and testis, indicating that it may play a key role in several organs. CA13 is inhibited by acetazolamide.
Function
Reversible hydration of carbon dioxide.
Protein Families
Alpha-carbonic anhydrase family
Tissue Specificity
Expressed in thymus, small intestine, spleen, prostate, ovary, colon and testis.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close