Comparison

Recombinant Human Carbonic anhydrase-related protein (CA8), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26988-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
CA8
Alternative Names
Carbonic Anhydrase-Related Protein, CARP, Carbonic Anhydrase VIII, CA-VIII, CA8, CALS
Uniprot
P35219
Source
E.coli
Expression Region
2-290aa
AA Sequence
ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVE WGLVFPDANGEYQSPINLNSREARYDPSLLDVRLS PNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQ GHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELH LIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEH VGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPL LRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQ IEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLS DRVIRAAFQ
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
34.04 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
0.2 um filtered 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The esterase activity is determined to be greater than 100 pmol/min/ug
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Carbonic Anhydrase 8 (CA8) belongs to the alpha-carbonic anhydrase family. Alpha-carbonic anhydrase is a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. Because CA8 has some sequence similarity with other known carbonic anhydrase genes, it was firstly called as CA-related protein. Nevertheless, CA8 does not have a carbonic anhydrase catalytic activity. Defects in CA8 are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 3 (CMARQ3), which is a congenital cerebellar ataxia associated with dysarthia, quadrupedal gait and mild mental retardation.
Function
Does not have a carbonic anhydrase catalytic activity.
Involvement in disease
Cerebellar ataxia, mental retardation, and dysequilibrium syndrome 3 (CMARQ3)
Protein Families
Alpha-carbonic anhydrase family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close