Comparison

Recombinant Human Cytotoxic and regulatory T-cell molecule (CRTAM), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26990-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
CRTAM
Alternative Names
Cytotoxic and Regulatory T-Cell Molecule, Class-I MHC-Restricted T-Cell-Associated Molecule, CD355, CRTAM
Uniprot
O95727
Source
Mammalian cell
Expression Region
18-286aa
AA Sequence
SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLT PSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPN VTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPI LEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLG NSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNS TVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDA LERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKE QTTQDPDLTTEANPQYLGLARKKS
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
30.99 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human CADM1 in functional ELISA is less than 20 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Cytotoxic and Regulatory T-Cell Molecule (CRTAM) is a member of Nectin family under the immunoglobulin superfamily that is expressed by activated CD8+ and NK T cells. CRTAM is found in spleen, thymus, small intestine, peripheral blood, and it is highly expressed by Purkinje cells of the cerebellum. CRTAM is a type I transmembrane glycoprotein containing one Ig-like C2-type domain and one Ig-like V-type domain in its extracellular domain, while its cytoplasmic region shows a potential class I PDZ domain. CRTAM is expressed as a homodimer on the cell surface but does not show homotypic binding in trans. The high affinity of CRTAM/IGSF4 adhesion allows CRTAM to disrupt IGSF4 homotypic interactions. IGSF4 and T cell receptor coengagement of CD8+ cells expressiong CRTAM induces increased IFNgamma or IL-22 production.
Function
Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and interferon-gamma (IFN-gamma) secretion by CD8+ cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM3 in vivo.
Subcellular location
Membrane, Single-pass type I membrane protein
Protein Families
Nectin family
Tissue Specificity
In the immune system, expression is restricted to activated class-I MHC-restricted cells, including NKT and CD8 cells. Strongly expressed in spleen, thymus, small intestine, peripheral blood leukocyte, and in Purkinje neurons in cerebellum. Expressed at much lower levels in testis, ovary, colon, lung and lymphoid tissues.

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close