Comparison

Recombinant Human Integrin alpha-5 (ITGA5), partial (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26991-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
ITGA5
Alternative Names
Integrin Alpha-5, CD49 Antigen-Like Family Member E, Fibronectin Receptor Subunit Alpha, Integrin Alpha-F, VLA-5, CD49e, ITGA5, FNRA
Uniprot
P08648
Source
Mammalian cell
Expression Region
42-995aa
AA Sequence
FNLDAEAPAVLSGPPGSFFGFSVEFYRPGTDGVSV LVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPI EFDSKGSRLLESSLSSSEGEEPVEYKSLQWFGATV RAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTD NFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKT GRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLI NLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDT EDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQ MASYFGYAVAATDVNGDGLDDLLVGAPLLMDRTPD GRPQEVGRVYVYLQHPAGIEPTPTLTLTGHDEFGR FGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVF VFPGGPGGLGSKPSQVLQPLWAASHTPDFFGSALR GGRDLDGNGYPDLIVGSFGVDKAVVYRGRPIVSAS ASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNA SGKHVADSIGFTVELQLDWQKQKGGVRRALFLASR QATLTQTLLIQNGAREDCREMKIYLRNESEFRDKL SPIHIALNFSLDPQAPVDSHGLRPALHYQSKSRIE DKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDK NALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGL VRHPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGA SLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQ SDVVSFRLSVEAQAQVTLNGVSKPEAVLFPVSDWH PRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLE LSCPQALEGQQLLYVTRVTGLNCTTNHPINPKGLE LDPEGSLHHQQKREAPSRSSASSGPQILKCPEAEC FRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQ PFSLQCEAVYKALKMPYRILPRQLPQKERQVATAV QWTKAEGSY
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
105.11 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human NovoNectin in functional ELISA is less than 50 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Integrin alpha-5 belongs to the Integrin alpha chain family and contains 7 FG-GAP repeats. Integrin alpha-5 joins with Integrin-beta1 to form a fibronectin and laminin receptor which recognizes the sequence R-G-D in its ligands. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. It is expressed on fibroblasts, endothelial cells, peripheral T cells and platelets. Integrin alpha-5 undergoes post-translational cleavage in the extracellular domain to yield disulfide-linked light and heavy chains. In addition to adhesion, ITGA5 participates in cell-surface mediated signalling.
Function
Integrin alpha-5/beta-1 is a receptor for fibronectin and fibrinogen. It recognizes the sequence R-G-D in its ligands. ITGA5
Subcellular location
Membrane, Single-pass type I membrane protein, Cell junction, focal adhesion, Cell surface
Protein Families
Integrin alpha chain family
Paythway
PI3K-Aktsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close