Comparison

Recombinant Human Lysosome-associated membrane glycoprotein 2 (LAMP2), partial (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26993-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
LAMP2
Alternative Names
Lysosome-Associated Membrane Glycoprotein 2, LAMP-2, Lysosome-Associated Membrane Protein 2, CD107 Antigen-Like Family Member B, CD107b, LAMP2
Uniprot
P13473
Source
Mammalian cell
Expression Region
29-375aa
AA Sequence
LELNLTDSENATCLYAKWQMNFTVRYETTNKTYKT VTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSW IANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKG ILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHY WDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHT TVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMG LQLNITQDKVASVININPNTTHSTGSCRSHTALLR LNSSTIKYLDFVFAVKNENRFYLKEVNISMYLVNG SVFSIANNNLSYWDAPLGSSYMCNKEQTVSVSGAF QINTFDLRVQPFNVTQGKYSTAQDCSADDDNF
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
33.94 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human LGALS-3 in functional ELISA is less than 30 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Lysosomal Associated Membrane Protein 2 (LAMP2) is a major component of lysosomal membranes. LAMP2 is a transmembrane glycoprotein about 110kDa. Mature human LAMP2 consists of a 347 amino acid (aa) intralumenal domain, a 24 aa transmembrane segment, and a 35 aa cytoplasmic tail . The lumenal domain is organized into two heavily N-glycosylated regions. Alternate splicing generates a human LAMP2 isoform (LAMP2B) with a substituted juxtamembrane lumenal region, cytoplasmic tail and transmenmbrane segment.LAMP2 itself can cleavage lysosomal luminal domain and degradation lysosomal. In the help of chaperone HSC73, LAMP2 mediates the lysosomal uptake in complex with cargo proteins and is required for the lysosomal destruction of autophagic vacuoles.
Function
Plays an important role in chaperone-mediated autophagy, a process that mediates lysosomal degradation of proteins in response to various stresses and as part of the normal turnover of proteins with a long biological half-live
Involvement in disease
Danon disease (DAND)
Subcellular location
Cell membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein, Cytoplasmic vesicle, autophagosome membrane
Protein Families
LAMP family
Tissue Specificity
Isoform LAMP-2A is highly expressed in placenta, lung and liver, less in kidney and pancreas, low in brain and skeletal muscle (PubMed:7488019, PubMed:26856698). Isoform LAMP-2B is detected in spleen, thymus, prostate, testis, small intestine, colon, skeletal muscle, brain, placenta, lung, kidney, ovary and pancreas and liver (PubMed:7488019, PubMed:26856698). Isoform LAMP-2C is detected in small intestine, colon, heart, brain, skeletal muscle, and at lower levels in kidney and placenta (PubMed:26856698).
Paythway
Autophagy-animal

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close