Comparison

Recombinant Human Syndecan-2 (SDC2), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26994-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
SDC2
Alternative Names
Syndecan-2, SYND2, Fibroglycan, Heparan Sulfate Proteoglycan Core Protein, HSPG, CD362, SDC2, HSPG1
Uniprot
P34741
Source
Mammalian cell
Expression Region
19-144aa
AA Sequence
ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYAS ASGSGADEDVESPELTTSRPLPKILLTSAAPKVET TTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDP AEEDTNVYTEKHSDSLFKRTE
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
14.98 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um Filtered 20 mM Tris-Citrate, 150 mM NaCl, pH 7.0
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human FGFb in functional ELISA is less than 5 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Syndecan-2 is a member of the Syndecans family comprised of type I transmembrane heparan sulfate proteoglycans (HSPG) that are involved in the regulation of many cellular processes. Four sub-types of mammalian Syndecans have been reported and among them. Syndecan-2 plays a role in the cancer development. It can affect the basal and chemotherapy-induced apoptosis in osteosarcoma. It can also suppress MMP2 activation, suppressing metastasis.
Function
Cell surface proteoglycan that bears heparan sulfate. Regulates dendritic arbor morphogenesis (By similarity).
Subcellular location
Membrane, Single-pass type I membrane protein
Protein Families
Syndecan proteoglycan family

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close