Comparison

Recombinant Human Vesicle-associated membrane protein-associated protein B/C (VAPB), partial (Active)

We do not sell to patients, medical doctors, pharmacies nor private persons! Read further

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26995-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
VAPB
Alternative Names
Vesicle-associated membrane protein-associated protein B/C, VAMP-B/VAMP-C, VAMP-associated protein B/C, VAP-B/VAP-C
Uniprot
O95292
Source
E.coli
Expression Region
2-132aa
AA Sequence
AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPT DRNVCFKVKTTAPRRYCVRPNSGIIDAGASINVSV MLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVW KEAKPEDLMDSKLRCVFELPAENDKP
Sequence Info
Partial
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
16 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human EphB2 in functional ELISA is less than 20 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
vesicle-associated membrane protein-associated protein B/C (VAPB) is presents in mitochondria-associated membranes that are endoplasmic reticulum membrane regions closely apposed to the outer mitochondrial membrane. It can form homodimer, and heterodimer with VAPA. It also interacts with VAMP1, VAMP2, HCV NS5A, NS5B, ZFYVE27 and RMDN3. VAPB participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. It is involved in cellular calcium homeostasis regulation.
Function
Participates in the endoplasmic reticulum unfolded protein response (UPR) by inducing ERN1/IRE1 activity. Involved in cellular calcium homeostasis regulation.
Involvement in disease
Amyotrophic lateral sclerosis 8 (ALS8); Spinal muscular atrophy, proximal, adult, autosomal dominant (SMAPAD)
Subcellular location
Endoplasmic reticulum membrane, Single-pass type IV membrane protein
Protein Families
VAMP-associated protein (VAP) (TC 9.B.17) family
Tissue Specificity
Ubiquitous. Isoform 1 predominates.
Paythway
Cholesterolmetabolism

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close