Comparison

Recombinant Human Inhibin beta C chain (INHBC) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26997-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
INHBC
Alternative Names
Inhibin Beta C Chain, Activin Beta-C Chain, INHBC
Uniprot
P55103
Source
Mammalian cell
Expression Region
19-352aa
AA Sequence
TPRAGGQCPACGGPTLELESQRELLLDLAKRSILD KLHLTQRPTLNRPVSRAALRTALQHLHGVPQGALL EDNREQECEIISFAETGLSTINQTRLDFHFSSDRT AGDREVQQASLMFFVQLPSNTTWTLKVRVLVLGPH NTNLTLATQYLLEVDASGWHQLPLGPEAQAACSQG HLTLELVLEGQVAQSSVILGGAAHRPFVAARVRVG GKHQIHRRGIDCQGGSRMCCRQEFFVDFREIGWHD WIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAV LNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRD SNIVKTDIPDMVVEACGCS
Sequence Info
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Theoretical MW
37.5 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human Activin RIIA in functional ELISA is less than 15 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Inhibin beta C chain, also known as activin beta-C chain and INHBC, belongs to the TGF-beta family. INHBC forms a homodimeric or heterodimeric through association with alpha and beta subunits, linked by one or more disulfide bonds. Inhibins are heterodimers of one alpha and one beta subunit. Activins are homo- or heterodimers of beta subunits only. Inhibins/activins regulates many physiological processes, such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth and so on.
Function
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Subcellular location
Secreted
Protein Families
TGF-beta family
Tissue Specificity
Expressed in benign prostatic hyperplasia.
Paythway
TGF-betasignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close