Comparison

Recombinant Human UL16-binding protein 2 (ULBP2), partial (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC26998-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
ULBP2
Alternative Names
NKG2D Ligand 2, N2DL-2, NKG2DL2, ALCAN-Alpha, Retinoic Acid Early Transcript 1H, UL16-Binding Protein 2, ULBP2, N2DL2, RAET1H
Uniprot
Q9BZM5
Source
Mammalian cell
Expression Region
26-217aa
AA Sequence
GRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKT FLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLR EVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQK AEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGA RKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMG MDSTLEPSAGAPLAMSS
Sequence Info
Partial
Tag Info
C-terminal FC-tagged
Theoretical MW
51.4 kDa
Purity
>90% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined by its ability to bind Human ULBP-2 in functional ELISA is less than 30 ug/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
NKG2D Ligand 2 (N2DL2) is a member of a family of cell-surface proteins. N2DL2 function as ligands for human cytomegalovirus glycoprotein UL16. N2DL2 is anchored to the membrane via a GPI-linkage. N2DL2 is bind to human NKG2D, an activating receptor expressed on NK cells, NKT cells, T cells. Engagement of NKG2D results in the activation of cytolytic activity and cytokine production by these effects cells. The ULBPs are expressed on some tumor cells and have been implicated in tumor surveillance.
Function
Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
Subcellular location
Cell membrane, Lipid-anchor, GPI-anchor, Endoplasmic reticulum, Secreted
Protein Families
MHC class I family
Tissue Specificity
Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues.
Paythway
Naturalkillercellmediatedcytotoxicity

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close