Comparison

Recombinant Human Thioredoxin (TXN) (Active)

Manufacturer Biomatik
Category
Type Proteins Recombinant
Specific against Human
Amount 50ug
Item no. BM-RPC27000-50ug
eClass 6.1 34160400
eClass 9.0 42020190
Available
Gene Name
TXN
Alternative Names
Thioredoxin, Trx, ATL-Derived Factor, ADF, Surface-Associated Sulphydryl Protein, SASP, TXN, TRDX, TRX, TRX1
Uniprot
P10599
Source
E.coli
Expression Region
1-105aa
AA Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPC KMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECE VKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Sequence Info
Full Length
Tag Info
N-terminal 6xHis-tagged
Theoretical MW
13.9 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 0.1 Abs/min/mg.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Thioredoxin (TXN) is a member of the Thioredoxin family. Thioredoxin exists as a disulfide-linked homodimer and contains one Thioredoxin domain. Thioredoxin is up-regulated by ionizing radiation. Thioredoxin participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Thioredoxin also plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide.
Function
Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.; FUNCTION
Subcellular location
Nucleus, Cytoplasm, Secreted
Protein Families
Thioredoxin family
Paythway
NOD-likereceptorsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet and Safety Datasheet) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

Amount: 50ug
Available: In stock
available
Questions about this Product?
 
Close